PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 279aa    MW: 31906.4 Da    PI: 9.2112
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0798genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.3e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l  +++q+G g+W++ +++ g++R++k+c++rw +yl
      Gh_D13G0798 17 RGPWTAEEDQILMAYIQQHGHGNWRALPEKAGLKRCGKSCRLRWINYL 64
                     89********************************************97 PP

2Myb_DNA-binding40.65.9e-1370114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+  +++++++lG++ W++ a++++ +Rt++++k++w+++l
      Gh_D13G0798  70 RGKFSLQEHT-IIQLHALLGNR-WSAMAAHLP-KRTDNEIKNYWNTHL 114
                      6788888885.78*********.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.9951268IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-241467IPR009057Homeodomain-like
SuperFamilySSF466893.03E-2814110IPR009057Homeodomain-like
SMARTSM007171.0E-141666IPR001005SANT/Myb domain
PfamPF002491.2E-161764IPR001005SANT/Myb domain
CDDcd001675.39E-111964No hitNo description
Gene3DG3DSA:1.10.10.609.7E-2368119IPR009057Homeodomain-like
SMARTSM007178.8E-1169116IPR001005SANT/Myb domain
PROSITE profilePS5129415.41569118IPR017930Myb domain
PfamPF002498.3E-1270114IPR001005SANT/Myb domain
CDDcd001674.46E-872114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGWRLPFNGH KEVGLKRGPW TAEEDQILMA YIQQHGHGNW RALPEKAGLK RCGKSCRLRW  60
INYLRPDIKR GKFSLQEHTI IQLHALLGNR WSAMAAHLPK RTDNEIKNYW NTHLKKRLIK  120
LGVDPMTHKP RTDASSFPSG SNLTHMAQWE SARLEAEARL VRDSKQVIPN PIHPKNHLTL  180
NHSQLRPRCL DVLKAWQGVV AGMFAFPTQD LGSPTSTLRF PAIGLNATSY TDGEMGFDDS  240
LKCIENSNQM KEIEETITDG CIDEWFEDSF RVGNYENVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23151185108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.103604e-52boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461874e-52
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362833e-49AF336283.1 Gossypium hirsutum GHMYB25 (ghmyb25) mRNA, complete cds.
GenBankEU8264653e-49EU826465.1 Gossypium hirsutum cultivar Acala Maxxa R2R3 MYB transcription factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461787.10.0PREDICTED: myb-related protein Pp1-like
TrEMBLA0A0D2TXV60.0A0A0D2TXV6_G
STRINGPOPTR_0008s08920.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2244245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.14e-86myb domain protein 106